HPA007308

Image

1 of 2 More...

Last 5 Products Viewed

HPA007308

Sigma

 

Anti-NQO1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Human Protein Atlas Number:HPA007308 Image Gallery

Description

ApplicationPrestige Antibodies® Powered by Atlas Antibodies are developed and validated by the Human Proteome Resource (HPR) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
ImmunogenImmunogen sequence: FRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR
 NAD(P)H dehydrogenase [quinone] 1 recombinant protein epitope signature tag (PrEST)
Physical formSolution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Biotechnology LP and Sigma-Aldrich Co.

Properties

antibody formaffinity isolated antibody
gradePrestige Antibodies® Powered by Atlas Antibodies
formbuffered aqueous glycerol solution
species reactivityhuman
application(s)immunoblotting: suitable
 immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
 protein array: suitable
Gene Informationhuman ... NQO1(1728)
shipped inwet ice
storage temp.−20°C

Related Products

Related productD1315, DT Diaphorase human
 D1190, DT Diaphorase from rat
 N5288, Anti-NQO1 (C-terminal) antibody produced in rabbit